Product Name:

Bovine TMEM101 ELISA Kit

  Contact Us
Alternative name: Bovine transmembrane protein 101 ELISA Kit;
Catalog: E100487
species: Bovine
Gene: TMEM101
Other Species: Human TMEM101 ELISA Kit
Mouse Tmem101 ELISA Kit
Intended Use: Bovine TMEM101 ELISA Kit allows for the in vitro quantitative determination of TMEM101 , concentrations in serum, Plasma , tissue homogenates and Cell culture supernates and Other biological fluids.
Storage: Store the whole ELISA kit at 4℃
  Bovine Transmembrane protein 101 Protein information
Uniprot ID TM101_BOVIN
Uniprot AC Q2KIB3;
UniGene Bt.2426;
>GeneID 515507
KEGG bta:515507;
Bovine Transmembrane protein 101 Protein SEQUENCE SEQUENCE 257 AA; 28683 MW; F2477CA0BA92F23D CRC64;
MASKTGSRRWMLQLIMQLGSVLLTRCPFWGCFSQLMLYAERAEARRKPDIPVPYLYFDMG AAVLCASFMSFGVKRRWFALGAALQLAISTYAAYVGGYVHYGDWLKVRMYSRTVAIIGGF LVLASGAGELYRRKPRSRSLQSTGQVFLGVYLVCVAYSLQHSKEDRLAYLNHLPGGELMV QLFFVLYGVLALAFLSGYYVTLAAQILAVLLPPVMLLIDGNVAYWHNTRRVEFWNQMKLL GESVGIFGAAVILATDG