Product Name:

Human TNFRSF18 ELISA Kit

  Contact Us
Alternative name: Human activation-inducible TNFR family receptor ELISA Kit;Human glucocorticoid-induced TNFR-related protein ELISA Kit;Human AITR ELISA Kit;Human GITR ELISA Kit;Human CD357 ELISA Kit;Human GITR-D ELISA Kit;Human TNF receptor superfamily member 18 ELISA Kit;Human tumor necrosis factor receptor superfamily member 18 ELISA Kit;Human TNF receptor superfamily activation-inducible protein ELISA Kit;
Catalog: E016427
species: Human
Gene: TNFRSF18
Standard Curve Human TNFRSF18 ELISA Kit
Other Species: Mouse Tnfrsf18 ELISA Kit
Samples: Serum, Plasma , tissue homogenates,Cell culture supernates,Other biological fluids.
Sensitivity: 10 pg/ml
Intended Use: Human TNFRSF18 ELISA Kit allows for the in vitro quantitative determination of TNFRSF18 , concentrations in serum, Plasma , tissue homogenates and Cell culture supernates and Other biological fluids.
Storage: Store the whole ELISA kit at 4℃
Product Description specifical Sandwich ELISA for quantitative detection of Human GITR concentrations.
  Human Tumor necrosis factor receptor superfamily member 18 Protein information
Uniprot ID TNR18_HUMAN
Uniprot AC Q9Y5U5; B1AME1; O95851; Q5U0I4; Q9NYJ9;
UniGene Hs.212680;
>GeneID 8784
KEGG hsa:8784;
Human Tumor necrosis factor receptor superfamily member 18 Protein SEQUENCE SEQUENCE 241 AA; 26000 MW; 90DC3B4AA7E82CBE CRC64;
MAQHGAMGAFRALCGLALLCALSLGQRPTGGPGCGPGRLLLGTGTDARCCRVHTTRCCRD YPGEECCSEWDCMCVQPEFHCGDPCCTTCRHHPCPPGQGVQSQGKFSFGFQCIDCASGTF SGGHEGHCKPWTDCTQFGFLTVFPGNKTHNAVCVPGSPPAEPLGWLTVVLLAVAACVLLL TSAQLGLHIWQLRSQCMWPRETQLLLEVPPSTEDARSCQFPEEERGERSAEEKGRLGDLW V
UCSC uc001adb.4; human. [Q9Y5U5-1];