Product Name:

Human G6PC2 ELISA Kit

  Contact Us
Alternative name: Human G-6-Pase 2 ELISA Kit;Human G6Pase 2 ELISA Kit;Human islet-specific glucose-6-phosphatase catalytic subunit-related protein ELISA Kit;Human IGRP ELISA Kit;Human glucose-6-phosphatase catalytic subunit 2 ELISA Kit;Human glucose-6-phosphatase 2 ELISA Kit;Human glucose-6-phosphatase, catalytic, 2 ELISA Kit;Human islet-specific G6CP-related protein ELISA Kit;Human islet-specific glucose-6-phosphatase-related protein ELISA Kit;
Catalog: E016648
species: Human
Gene: G6PC2
Other Species: Mouse G6pc2 ELISA Kit
Samples: Serum, Plasma , tissue homogenates,Cell culture supernates,Other biological fluids.
Intended Use: Human G6PC2 ELISA Kit allows for the in vitro quantitative determination of G6PC2 , concentrations in serum, Plasma , tissue homogenates and Cell culture supernates and Other biological fluids.
Storage: Store the whole ELISA kit at 4℃
  Human Glucose-6-phosphatase 2 Protein information
Uniprot ID G6PC2_HUMAN
Uniprot AC Q9NQR9; E9PAX2; Q6AHZ0;
UniGene Hs.283963;
>GeneID 57818
KEGG hsa:57818;
Human Glucose-6-phosphatase 2 Protein SEQUENCE SEQUENCE 355 AA; 40580 MW; D642C37496B6C4EB CRC64;
MDFLHRNGVLIIQHLQKDYRAYYTFLNFMSNVGDPRNIFFIYFPLCFQFNQTVGTKMIWV AVIGDWLNLIFKWILFGHRPYWWVQETQIYPNHSSPCLEQFPTTCETGPGSPSGHAMGAS CVWYVMVTAALSHTVCGMDKFSITLHRLTWSFLWSVFWLIQISVCISRVFIATHFPHQVI LGVIGGMLVAEAFEHTPGIQTASLGTYLKTNLFLFLFAVGFYLLLRVLNIDLLWSVPIAK KWCANPDWIHIDTTPFAGLVRNLGVLFGLGFAINSEMFLLSCRGGNNYTLSFRLLCALTS LTILQLYHFLQIPTHEEHLFYVLSFCKSASIPLTVVAFIPYSVHMLMKQSGKKSQ
UCSC uc002uem.4; human. [Q9NQR9-1];