Product Name:

Human GPX4 ELISA Kit

  Contact Us
Alternative name: Human PHGPx ELISA Kit;Human glutathione peroxidase 4 ELISA Kit;Human GPx-4 ELISA Kit;Human GSHPx-4 ELISA Kit;Human MCSP ELISA Kit;Human SMDS ELISA Kit;Human snGPx ELISA Kit;Human snPHGPx ELISA Kit;Human phospholipid hydroperoxide glutathione peroxidase, mitochondrial ELISA Kit;Human phospholipid hydroperoxide glutathione peroxidase ELISA Kit;Human phospholipid hydroperoxidase ELISA Kit;Human sperm nucleus glutathione peroxidase ELISA Kit;
Catalog: E016895
species: Human
Gene: GPX4
Standard Curve Human GPX4 ELISA Kit
Other Species: Mouse Gpx4 ELISA Kit
Rat Gpx4 ELISA Kit
Bovine GPX4 ELISA Kit
Porcine GPX4 ELISA Kit
Specificity: This assay has high sensitivity and excellent specificity for detection of human GPX4. No significant cross-reactivity or interference between human GPX4 and analogues was observed.
Samples: Serum, Plasma , tissue homogenates,Cell culture supernates,Other biological fluids.
Sensitivity: The minimum detectable dose of human GPX4 is typically less than 1.95 uU/ml. The sensitivity of this assay, or Lower Limit of Detection (LLD) was defined as the lowest protein concentration that could be differentiated from zero. It was determined the mea
Intended Use: Human GPX4 ELISA Kit allows for the in vitro quantitative determination of GPX4 , concentrations in serum, Plasma , tissue homogenates and Cell culture supernates and Other biological fluids.
Storage: Store the whole ELISA kit at 4℃
Product Description specifical Principle of the assay: This assay employs the quantitative sandwich enzyme immunoassay technique. Antibody specific for GPX4 has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and any GPX4 present is bound by the immobilized antibody. After removing any unbound substances, a biotin-conjugated antibody specific for GPX4 is added to the wells. After washing, avidin conjugated Horseradish Peroxidase (HRP) is added to the wells. Following a wash to remove any unbound avidin-enzyme reagent, a substrate solution is added to the wells and color develops in proportion to the amount of GPX4 bound in the initial step. The color development is stopped and the intensity of the color is measured.
  Human Phospholipid hydroperoxide glutathione peroxidase, mitochondrial Protein information
Uniprot ID GPX4_HUMAN
Uniprot AC P36969; O43381; Q6PJ59; Q9UPK2;
UniGene Hs.433951;
>GeneID 2879
KEGG hsa:2879;
Human Phospholipid hydroperoxide glutathione peroxidase, mitochondrial Protein SEQUENCE SEQUENCE 197 AA; 22175 MW; 1AE3BC7AE42FDDB1 CRC64;
MSLGRLCRLLKPALLCGALAAPGLAGTMCASRDDWRCARSMHEFSAKDIDGHMVNLDKYR GFVCIVTNVASQUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFA AGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRY GPMEEPLVIEKDLPHYF
UCSC uc021umg.3; human. [P36969-1];
Related products with Human GPX4 ELISA Kit