Product Name:

Human GOSR2 ELISA Kit

  Contact Us
Alternative name: Human 27 kDa Golgi SNARE protein ELISA Kit;Human membrin ELISA Kit;Human GS27 ELISA Kit;Human Bos1 ELISA Kit;Human EPM6 ELISA Kit;Human Golgi SNAP receptor complex member 2 ELISA Kit;
Catalog: E017289
species: Human
Gene: GOSR2
Other Species: Mouse Gosr2 ELISA Kit
Rat Gosr2 ELISA Kit
Samples: Serum, Plasma , tissue homogenates,Cell culture supernates,Other biological fluids.
Intended Use: Human GOSR2 ELISA Kit allows for the in vitro quantitative determination of GOSR2 , concentrations in serum, Plasma , tissue homogenates and Cell culture supernates and Other biological fluids.
Storage: Store the whole ELISA kit at 4℃
  Human Golgi SNAP receptor complex member 2 Protein information
Uniprot ID GOSR2_HUMAN
Uniprot AC O14653; D3DXJ5; D3DXJ6; Q8N4B8; Q96DA5; Q9BZZ4;
UniGene Hs.463278; Hs.596195;
>GeneID 9570
KEGG hsa:9570;
Human Golgi SNAP receptor complex member 2 Protein SEQUENCE SEQUENCE 212 AA; 24775 MW; 4D5585CF858A610F CRC64;
MDPLFQQTHKQVHEIQSCMGRLETADKQSVHIVENEIQASIDQIFSRLERLEILSSKEPP NKRQNARLRVDQLKYDVQHLQTALRNFQHRRHAREQQERQREELLSRTFTTNDSDTTIPM DESLQFNSSLQKVHNGMDDLILDGHNILDGLRTQRLTLKGTQKKILDIANMLGLSNTVMR LIEKRAFQDKYFMIGGMLLTCVVMFLVVQYLT
UCSC uc002iky.4; human. [O14653-1];
Related products with Human GOSR2 ELISA Kit