Product Name:

Human GADD45GIP1 ELISA Kit

  Contact Us
Alternative name: Human 39S ribosomal protein L59, mitochondrial ELISA Kit;Human MRP-L59 ELISA Kit;Human CKII beta-associating protein ELISA Kit;Human CR6-interacting factor 1 ELISA Kit;Human CRIF1 ELISA Kit;Human Papillomavirus L2-interacting nuclear protein 1 ELISA Kit;Human PLINP ELISA Kit;Human PLINP-1 ELISA Kit;Human p53-responsive gene 6 protein ELISA Kit;Human MRPL59 ELISA Kit;Human Plinp1 ELISA Kit;Human PRG6 ELISA Kit;Human CKBBP2 ELISA Kit;Human CKbetaBP2 ELISA Kit;Human GADD45G interacting protein 1 ELISA Kit;Human growth arrest and DNA damage-inducible proteins-interacting protein 1 ELISA Kit;Human CKII beta binding protein 2 ELISA Kit;Human CR6 interacting factor 1 ELISA Kit;Human growth arrest and DNA-damage-inducible, gamma interacting protein 1 ELISA Kit;Human growth arrest- and DNA damage-inducible GADD45G-interacting protein ELISA Kit;Human papillomavirus L2 interacting nuclear protein 1 ELISA Kit;
Catalog: E017502
species: Human
Gene: GADD45GIP1
Other Species: Mouse Gadd45gip1 ELISA Kit
Bovine GADD45GIP1 ELISA Kit
Rat Gadd45gip1 ELISA Kit
Samples: Serum, Plasma , tissue homogenates,Cell culture supernates,Other biological fluids.
Intended Use: Human GADD45GIP1 ELISA Kit allows for the in vitro quantitative determination of GADD45GIP1 , concentrations in serum, Plasma , tissue homogenates and Cell culture supernates and Other biological fluids.
Storage: Store the whole ELISA kit at 4℃
  Human Growth arrest and DNA damage-inducible proteins-interacting protein 1 Protein information
Uniprot ID G45IP_HUMAN
Uniprot AC Q8TAE8; Q8IVM3; Q8TE51; Q969P9; Q9BSM6;
UniGene Hs.515164;
>GeneID 90480
KEGG hsa:90480;
Human Growth arrest and DNA damage-inducible proteins-interacting protein 1 Protein SEQUENCE SEQUENCE 222 AA; 25384 MW; 304C397AEC958804 CRC64;
MAASVRQARSLLGVAATLAPGSRGYRARPPPRRRPGPRWPDPEDLLTPRWQLGPRYAAKQ FARYGAASGVVPGSLWPSPEQLRELEAEEREWYPSLATMQESLRVKQLAEEQKRREREQH IAECMAKMPQMIVNWQQQQRENWEKAQADKERRARLQAEAQELLGYQVDPRSARFQELLQ DLEKKERKRLKEEKQKRKKEARAAALAAAVAQDPAASGAPSS
UCSC uc002mwb.5; human.;
Related products with Human GADD45GIP1 ELISA Kit