Product Name:

Human GIMAP5 ELISA Kit

  Contact Us
Alternative name: Human Immunity-associated nucleotide 4-like 1 protein ELISA Kit;Human immunity-associated nucleotide 5 protein ELISA Kit;Human IAN-5 ELISA Kit;Human hIAN5 ELISA Kit;Human Immunity-associated protein 3 ELISA Kit;Human IAN4L1 ELISA Kit;Human IAN5 ELISA Kit;Human IMAP3 ELISA Kit;Human HIMAP3 ELISA Kit;Human IAN4 ELISA Kit;Human IROD ELISA Kit;Human GTPase, IMAP family member 5 ELISA Kit;Human GTPase IMAP family member 5 ELISA Kit;Human immune associated nucleotide 4 like 1 ELISA Kit;Human immune-associated nucleotide-binding protein 5 ELISA Kit;Human immunity associated protein 3 ELISA Kit;Human inhibitor of radiation- and OA-induced apoptosis, Irod/Ian5 ELISA Kit;
Catalog: E017708
species: Human
Gene: GIMAP5
Other Species: Mouse Gimap5 ELISA Kit
Rat Gimap5 ELISA Kit
Samples: Serum, Plasma , tissue homogenates,Cell culture supernates,Other biological fluids.
Intended Use: Human GIMAP5 ELISA Kit allows for the in vitro quantitative determination of GIMAP5 , concentrations in serum, Plasma , tissue homogenates and Cell culture supernates and Other biological fluids.
Storage: Store the whole ELISA kit at 4℃
  Human GTPase IMAP family member 5 Protein information
Uniprot ID GIMA5_HUMAN
Uniprot AC Q96F15; D3DWZ5; Q6IA75; Q96NE4; Q9NUK9;
UniGene Hs.647079; Hs.698139;
>GeneID 55340
KEGG hsa:55340;
Human GTPase IMAP family member 5 Protein SEQUENCE SEQUENCE 307 AA; 34846 MW; D219F52DE910C5BA CRC64;
MGGFQRGKYGTMAEGRSEDNLSATPPALRIILVGKTGCGKSATGNSILGQPVFESKLRAQ SVTRTCQVKTGTWNGRKVLVVDTPSIFESQADTQELYKNIGDCYLLSAPGPHVLLLVIQL GRFTAQDTVAIRKVKEVFGTGAMRHVVILFTHKEDLGGQALDDYVANTDNCSLKDLVREC ERRYCAFNNWGSVEEQRQQQAELLAVIERLGREREGSFHSNDLFLDAQLLQRTGAGACQE DYRQYQAKVEWQVEKHKQELRENESNWAYKALLRVKHLMLLHYEIFVFLLLCSILFFIIF LFIFHYI
UCSC uc003whr.3; human. [Q96F15-1];
Related products with Human GIMAP5 ELISA Kit