Product Name:

Human TMEM101 ELISA Kit

  Contact Us
Alternative name: Human putative NF-kappa-B-activating protein 130 ELISA Kit;Human transmembrane protein 101 ELISA Kit;
Catalog: E039156
species: Human
Gene: TMEM101
Other Species: Mouse Tmem101 ELISA Kit
Bovine TMEM101 ELISA Kit
Samples: Serum, Plasma , tissue homogenates,Cell culture supernates,Other biological fluids.
Intended Use: Human TMEM101 ELISA Kit allows for the in vitro quantitative determination of TMEM101 , concentrations in serum, Plasma , tissue homogenates and Cell culture supernates and Other biological fluids.
Storage: Store the whole ELISA kit at 4℃
  Human Transmembrane protein 101 Protein information
Uniprot ID TM101_HUMAN
Uniprot AC Q96IK0; B2R9N6;
UniGene Hs.514211;
>GeneID 84336
KEGG hsa:84336;
Human Transmembrane protein 101 Protein SEQUENCE SEQUENCE 257 AA; 28795 MW; F2939392B69AFB2D CRC64;
MASKIGSRRWMLQLIMQLGSVLLTRCPFWGCFSQLMLYAERAEARRKPDIPVPYLYFDMG AAVLCASFMSFGVKRRWFALGAALQLAISTYAAYIGGYVHYGDWLKVRMYSRTVAIIGGF LVLASGAGELYRRKPRSRSLQSTGQVFLGIYLICVAYSLQHSKEDRLAYLNHLPGGELMI QLFFVLYGILALAFLSGYYVTLAAQILAVLLPPVMLLIDGNVAYWHNTRRVEFWNQMKLL GESVGIFGTAVILATDG
UCSC uc002ieu.4; human.;