Product Name:

Human TMEM102 ELISA Kit

  Contact Us
Alternative name: Human common beta-chain associated protein ELISA Kit;Human CBAP ELISA Kit;Human transmembrane protein 102 ELISA Kit;
Catalog: E039157
species: Human
Gene: TMEM102
Other Species: Mouse Tmem102 ELISA Kit
Bovine TMEM102 ELISA Kit
Samples: Serum, Plasma , tissue homogenates,Cell culture supernates,Other biological fluids.
Intended Use: Human TMEM102 ELISA Kit allows for the in vitro quantitative determination of TMEM102 , concentrations in serum, Plasma , tissue homogenates and Cell culture supernates and Other biological fluids.
Storage: Store the whole ELISA kit at 4℃
  Human Transmembrane protein 102 Protein information
Uniprot ID TM102_HUMAN
Uniprot AC Q8N9M5; D3DTP8;
UniGene Hs.655662;
>GeneID 284114
KEGG hsa:284114;
Human Transmembrane protein 102 Protein SEQUENCE SEQUENCE 508 AA; 54175 MW; 27B3FDC1C30E3406 CRC64;
MASAVWGSAPWWGPPPPAPARPLTDIDFCSGAQLQELTQLIQELGVQESWSDGPKPGADL LRAKDFVFSLLGLVHRRDPRFPPQAELLLLRGGIREGSLDLGHAPLGPYARGPHYDAGFT LLVPMFSLDGTELQLDLESCYAQVCLPEMVCGTPIREMWQDCLGPPVPGARDSIHRTESE ESSKDWQSSVDQPHSYVTEHEAPVSLEKSPSDVSASESPQHDVVDLGSTAPLKTMSSDVT KAAVESPVPKPSEAREAWPTLCSAQVAAWFFATLAAVAESLIPVPGAPRLVHAARHAGFT TVLLATPEPPRRLLLFDLIPVVSVAGWPEGARSHSWAGPLASESASFYLVPGGGTERPCA SAWQLCFARQELALKARIPAPLLQAHAAAQALLRPLVAGTRAAAPYLLRTLLYWACERLP ALYLARPENAGACCLGLLDELGRVLEAGTLPHYFLNGRQLRTGDDSAALLGELARLRGDP ARALRAAVEEAKVARKGGGLAGVGGGAH
UCSC uc002ggx.1; human.;
Related products with Human TMEM102 ELISA Kit