Product Name:

Human TMEM104 ELISA Kit

  Contact Us
Alternative name: Human transmembrane protein 104 ELISA Kit;
Catalog: E039158
species: Human
Gene: TMEM104
Other Species: Mouse Tmem104 ELISA Kit
Chicken TMEM104 ELISA Kit
Samples: Serum, Plasma , tissue homogenates,Cell culture supernates,Other biological fluids.
Intended Use: Human TMEM104 ELISA Kit allows for the in vitro quantitative determination of TMEM104 , concentrations in serum, Plasma , tissue homogenates and Cell culture supernates and Other biological fluids.
Storage: Store the whole ELISA kit at 4℃
  Human Transmembrane protein 104 Protein information
Uniprot ID TM104_HUMAN
Uniprot AC Q8NE00; Q8TEU1; Q9NT56; Q9NXH1;
UniGene Hs.370262;
>GeneID 54868
KEGG hsa:54868;
Human Transmembrane protein 104 Protein SEQUENCE SEQUENCE 496 AA; 55679 MW; 4173D25DB4870426 CRC64;
MAGEITETGELYSSYVGLVYMFNLIVGTGALTMPKAFATAGWLVSLVLLVFLGFMSFVTT TFVIEAMAAANAQLHWKRMENLKEEEDDDSSTASDSDVLIRDNYERAEKRPILSVQRRGS PNPFEITDRVEMGQMASMFFNKVGVNLFYFCIIVYLYGDLAIYAAAVPFSLMQVTCSATG NDSCGVEADTKYNDTDRCWGPLRRVDAYRIYLAIFTLLLGPFTFFDVQKTKYLQILTSLM RWIAFAVMIVLALIRIGHGQGEGHPPLADFSGVRNLFGVCVYSFMCQHSLPSLITPVSSK RHLTRLVFLDYVLILAFYGLLSFTAIFCFRGDSLMDMYTLNFARCDVVGLAAVRFFLGLF PVFTISTNFPIIAVTLRNNWKTLFHREGGTYPWVVDRVVFPTITLVPPVLVAFCTHDLES LVGITGAYAGTGIQYVIPAFLVYHCRRDTQLAFGCGVSNKHRSPFRHTFWVGFVLLWAFS CFIFVTANIILSETKL
UCSC uc002jls.5; human. [Q8NE00-1];