Product Name:

Human TMEM105 ELISA Kit

  Contact Us
Alternative name: Human transmembrane protein 105 ELISA Kit;
Catalog: E039159
species: Human
Gene: TMEM105
Samples: Serum, Plasma , tissue homogenates,Cell culture supernates,Other biological fluids.
Intended Use: Human TMEM105 ELISA Kit allows for the in vitro quantitative determination of TMEM105 , concentrations in serum, Plasma , tissue homogenates and Cell culture supernates and Other biological fluids.
Storage: Store the whole ELISA kit at 4℃
  Human Transmembrane protein 105 Protein information
Uniprot ID TM105_HUMAN
Uniprot AC Q8N8V8;
UniGene Hs.364191;
>GeneID 284186
KEGG hsa:284186;
Human Transmembrane protein 105 Protein SEQUENCE SEQUENCE 129 AA; 13990 MW; FC17DF0141551265 CRC64;
MLLKVRRASLKPPATPHQGAFRAGNVIGQLIYLLTWSLFTAWLRPPTLLQGPRTSPQGSP PRSPWGDCAEPSCLCEMKIRRRRHEGPAWGQSGFLAGGLHLVPSSLSLAACGVVRMKGLW GRGAGIRGR
UCSC uc002kad.4; human.;