Product Name:

Human TMEM165 ELISA Kit

  Contact Us
Alternative name: Human transmembrane protein PT27 ELISA Kit;Human transmembrane protein TPARL ELISA Kit;Human TPARL ELISA Kit;Human CDG2K ELISA Kit;Human FT27 ELISA Kit;Human GDT1 ELISA Kit;Human TMPT27 ELISA Kit;Human transmembrane protein 165 ELISA Kit;Human TPA regulated locus ELISA Kit;
Catalog: E039223
species: Human
Gene: TMEM165
Other Species: Mouse Tmem165 ELISA Kit
Rat Tmem165 ELISA Kit
Samples: Serum, Plasma , tissue homogenates,Cell culture supernates,Other biological fluids.
Intended Use: Human TMEM165 ELISA Kit allows for the in vitro quantitative determination of TMEM165 , concentrations in serum, Plasma , tissue homogenates and Cell culture supernates and Other biological fluids.
Storage: Store the whole ELISA kit at 4℃
  Human Transmembrane protein 165 Protein information
Uniprot ID TM165_HUMAN
Uniprot AC Q9HC07; A8K3P8; B4DHW1; Q9BTN9; Q9NZ34;
UniGene Hs.479766;
>GeneID 55858
KEGG hsa:55858;
Human Transmembrane protein 165 Protein SEQUENCE SEQUENCE 324 AA; 34906 MW; A0E6C8BBFF189D72 CRC64;
MAAAAPGNGRASAPRLLLLFLVPLLWAPAAVRAGPDEDLSHRNKEPPAPAQQLQPQPVAV QGPEPARVEKIFTPAAPVHTNKEDPATQTNLGFIHAFVAAISVIIVSELGDKTFFIAAIM AMRYNRLTVLAGAMLALGLMTCLSVLFGYATTVIPRVYTYYVSTVLFAIFGIRMLREGLK MSPDEGQEELEEVQAELKKKDEEFQRTKLLNGPGDVETGTSITVPQKKWLHFISPIFVQA LTLTFLAEWGDRSQLTTIVLAAREDPYGVAVGGTVGHCLCTGLAVIGGRMIAQKISVRTV TIIGGIVFLAFAFSALFISPDSGF
UCSC uc003hax.4; human. [Q9HC07-1];
Related products with Human TMEM165 ELISA Kit