Product Name:

Human TMEM216 ELISA Kit

  Contact Us
Alternative name: Human HSPC244 ELISA Kit;Human transmembrane protein 216 ELISA Kit;
Catalog: E039286
species: Human
Gene: TMEM216
Other Species: Mouse Tmem216 ELISA Kit
Bovine TMEM216 ELISA Kit
Rat Tmem216 ELISA Kit
Samples: Serum, Plasma , tissue homogenates,Cell culture supernates,Other biological fluids.
Intended Use: Human TMEM216 ELISA Kit allows for the in vitro quantitative determination of TMEM216 , concentrations in serum, Plasma , tissue homogenates and Cell culture supernates and Other biological fluids.
Storage: Store the whole ELISA kit at 4℃
  Human Transmembrane protein 216 Protein information
Uniprot ID TM216_HUMAN
Uniprot AC Q9P0N5; A8MZ23; B7Z8N1;
UniGene Hs.26745;
>GeneID 51259
KEGG hsa:51259;
Human Transmembrane protein 216 Protein SEQUENCE SEQUENCE 145 AA; 16487 MW; 0F5024FB2B96D6CB CRC64;
MLPRGLKMAPRGKRLSSTPLEILFFLNGWYNATYFLLELFIFLYKGVLLPYPTANLVLDV VMLLLYLGIEVIRLFFGTKGNLCQRKMPLSISVALTFPSAMMASYYLLLQTYVLRLEAIM NGILLFFCGSELLLEVLTLAAFSRI
UCSC uc010rlj.3; human. [Q9P0N5-1];