Product Name:

Human TMEM86A ELISA Kit

  Contact Us
Alternative name: Human transmembrane protein 86A ELISA Kit;Human lysoplasmalogenase-like protein TMEM86A ELISA Kit;
Catalog: E039349
species: Human
Gene: TMEM86A
Other Species: Mouse Tmem86a ELISA Kit
Bovine TMEM86A ELISA Kit
Samples: Serum, Plasma , tissue homogenates,Cell culture supernates,Other biological fluids.
Intended Use: Human TMEM86A ELISA Kit allows for the in vitro quantitative determination of TMEM86A , concentrations in serum, Plasma , tissue homogenates and Cell culture supernates and Other biological fluids.
Storage: Store the whole ELISA kit at 4℃
  Human Lysoplasmalogenase-like protein TMEM86A Protein information
Uniprot ID TM86A_HUMAN
Uniprot AC Q8N2M4; Q96AJ0;
UniGene Hs.502100;
>GeneID 144110
KEGG hsa:144110;
Human Lysoplasmalogenase-like protein TMEM86A Protein SEQUENCE SEQUENCE 240 AA; 26398 MW; 2FABCC64A964BAA9 CRC64;
MVSPVTVVKSEGPKLVPFFKATCVYFVLWLPSSSPSWVSTLIKCLPIFCLWLFLLAHGLG FLLAHPSATRIFVGLVFSAVGDAFLIWQDQGYFVHGLLMFAVTHMFYASAFGMQPLALRT GLVMAALSGLCYALLYPCLSGAFTYLVGVYVALIGFMGWRAMAGLRLAGADWRWTELAAG SGALFFIISDLTIALNKFCFPVPYSRALIMSTYYVAQMLVALSAVESREPVEHYRLTKAN
UCSC uc001moz.2; human.;