Product Name:

Human TRIM2 ELISA Kit

  Contact Us
Alternative name: Human E3 ubiquitin-protein ligase TRIM2 ELISA Kit;Human RING finger protein 86 ELISA Kit;Human RING-type E3 ubiquitin transferase TRIM2 {ECO:0000305} ELISA Kit;Human KIAA0517 ELISA Kit;Human RNF86 ELISA Kit;Human CMT2R ELISA Kit;Human tripartite motif containing 2 ELISA Kit;Human tripartite motif-containing protein 2 ELISA Kit;Human tripartite motif protein TRIM2 ELISA Kit;
Catalog: E039477
species: Human
Gene: TRIM2
Other Species: Mouse Trim2 ELISA Kit
Bovine TRIM2 ELISA Kit
Rat Trim2 ELISA Kit
Specificity: This assay has high sensitivity and excellent specificity for detection of human TRIM2. No significant cross-reactivity or interference between human TRIM2 and analogues was observed.
Samples: Serum, Plasma , tissue homogenates,Cell culture supernates,Other biological fluids.
Sensitivity: The minimum detectable dose of human TRIM2 is typically less than 9.77 pg/ml. The sensitivity of this assay, or Lower Limit of Detection (LLD) was defined as the lowest protein concentration that could be differentiated from zero. It was determined the me
Intended Use: Human TRIM2 ELISA Kit allows for the in vitro quantitative determination of TRIM2 , concentrations in serum, Plasma , tissue homogenates and Cell culture supernates and Other biological fluids.
Storage: Store the whole ELISA kit at 4℃
Product Description specifical Principle of the assay: This assay employs the quantitative sandwich enzyme immunoassay technique. Antibody specific for TRIM2 has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and any TRIM2 present is bound by the immobilized antibody. After removing any unbound substances, a biotin-conjugated antibody specific for TRIM2 is added to the wells. After washing, avidin conjugated Horseradish Peroxidase (HRP) is added to the wells. Following a wash to remove any unbound avidin-enzyme reagent, a substrate solution is added to the wells and color develops in proportion to the amount of TRIM2 bound in the initial step. The color development is stopped and the intensity of the color is measured.
  Human Tripartite motif-containing protein 2 Protein information
Uniprot ID TRIM2_HUMAN
Uniprot AC Q9C040; D3DP09; O60272; Q9BSI9; Q9UFZ1;
UniGene Hs.435711;
>GeneID 23321
KEGG hsa:23321;
Human Tripartite motif-containing protein 2 Protein SEQUENCE SEQUENCE 744 AA; 81530 MW; B69A5876188B1A27 CRC64;
MASEGTNIPSPVVRQIDKQFLICSICLERYKNPKVLPCLHTFCERCLQNYIPAHSLTLSC PVCRQTSILPEKGVAALQNNFFITNLMDVLQRTPGSNAEESSILETVTAVAAGKPLSCPN HDGNVMEFYCQSCETAMCRECTEGEHAEHPTVPLKDVVEQHKASLQVQLDAVNKRLPEID SALQFISEIIHQLTNQKASIVDDIHSTFDELQKTLNVRKSVLLMELEVNYGLKHKVLQSQ LDTLLQGQESIKSCSNFTAQALNHGTETEVLLVKKQMSEKLNELADQDFPLHPRENDQLD FIVETEGLKKSIHNLGTILTTNAVASETVATGEGLRQTIIGQPMSVTITTKDKDGELCKT GNAYLTAELSTPDGSVADGEILDNKNGTYEFLYTVQKEGDFTLSLRLYDQHIRGSPFKLK VIRSADVSPTTEGVKRRVKSPGSGHVKQKAVKRPASMYSTGKRKENPIEDDLIFRVGTKG RNKGEFTNLQGVAASTNGKILIADSNNQCVQIFSNDGQFKSRFGIRGRSPGQLQRPTGVA VHPSGDIIIADYDNKWVSIFSSDGKFKTKIGSGKLMGPKGVSVDRNGHIIVVDNKACCVF IFQPNGKIVTRFGSRGNGDRQFAGPHFAAVNSNNEIIITDFHNHSVKVFNQEGEFMLKFG SNGEGNGQFNAPTGVAVDSNGNIIVADWGNSRIQVFDGSGSFLSYINTSADPLYGPQGLA LTSDGHVVVADSGNHCFKVYRYLQ
UCSC uc003ing.3; human. [Q9C040-1];
Related products with Human TRIM2 ELISA Kit