Product Name:

Human TSC22D1 ELISA Kit

  Contact Us
Alternative name: Human cerebral protein 2 ELISA Kit;Human regulatory protein TSC-22 ELISA Kit;Human TGFB-stimulated clone 22 homolog ELISA Kit;Human transforming growth factor beta-1-induced transcript 4 protein ELISA Kit;Human KIAA1994 ELISA Kit;Human TGFB1I4 ELISA Kit;Human TSC22 ELISA Kit;Human Ptg-2 ELISA Kit;Human TSC22 domain family member 1 ELISA Kit;Human TSC22 domain family protein 1 ELISA Kit;Human TGFbeta-stimulated clone 22 ELISA Kit;Human transcriptional regulator TSC-22 ELISA Kit;Human transforming growth factor beta-stimulated protein TSC-22 ELISA Kit;
Catalog: E039724
species: Human
Gene: TSC22D1
Other Species: Mouse Tsc22d1 ELISA Kit
Bovine TSC22D1 ELISA Kit
Chicken TSC22D1 ELISA Kit
Monkey TSC22D1 ELISA Kit
Rat Tsc22d1 ELISA Kit
Samples: Serum, Plasma , tissue homogenates,Cell culture supernates,Other biological fluids.
Intended Use: Human TSC22D1 ELISA Kit allows for the in vitro quantitative determination of TSC22D1 , concentrations in serum, Plasma , tissue homogenates and Cell culture supernates and Other biological fluids.
Storage: Store the whole ELISA kit at 4℃
  Human TSC22 domain family protein 1 Protein information
Uniprot ID T22D1_HUMAN
Uniprot AC Q15714; B3KRL7; B9EGI0; O00666; Q6AHX5; Q6IBU1; Q8NCN1; Q96JS5;
UniGene Hs.436383;
>GeneID 8848
KEGG hsa:8848;
Human TSC22 domain family protein 1 Protein SEQUENCE SEQUENCE 1073 AA; 109677 MW; BFA471E36FCD06BD CRC64;
MHQPPESTAAAAAAADISARKMAHPAMFPRRGSGSGSASALNAAGTGVGSNATSSEDFPP PSLLQPPPPAASSTSGPQPPPPQSLNLLSQAQLQAQPLAPGGTQMKKKSGFQITSVTPAQ ISASISSNNSIAEDTESYDDLDESHTEDLSSSEILDVSLSRATDLGEPERSSSEETLNNF QEAETPGAVSPNQPHLPQPHLPHLPQQNVVINGNAHPHHLHHHHQIHHGHHLQHGHHHPS HVAVASASITGGPPSSPVSRKLSTTGSSDSITPVAPTSAVSSSGSPASVMTNMRAPSTTG GIGINSVTGTSTVNNVNITAVGSFNPNVTSSMLGNVNISTSNIPSAAGVSVGPGVTSGVN VNILSGMGNGTISSSAAVSSVPNAAAGMTGGSVSSQQQQPTVNTSRFRVVKLDSSSEPFK KGRWTCTEFYEKENAVPATEGVLINKVVETVKQNPIEVTSERESTSGSSVSSSVSTLSHY TESVGSGEMGAPTVVVQQQQQQQQQQQQQPALQGVTLQQMDFGSTGPQSIPAVSIPQSIS QSQISQVQLQSQELSYQQKQGLQPVPLQATMSAATGIQPSPVNVVGVTSALGQQPSISSL AQPQLPYSQAAPPVQTPLPGAPPPQQLQYGQQQPMVSTQMAPGHVKSVTQNPASEYVQQQ PILQTAMSSGQPSSAGVGAGTTVIPVAQPQGIQLPVQPTAVPAQPAGASVQPVGQAPAAV SAVPTGSQIANIGQQANIPTAVQQPSTQVPPSVIQQGAPPSSQVVPPAQTGIIHQGVQTS APSLPQQLVIASQSSLLTVPPQPQGVEPVAQGIVSQQLPAVSSLPSASSISVTSQVSSTG PSGMPSAPTNLVPPQNIAQTPATQNGNLVQSVSQPPLIATNTNLPLAQQIPLSSTQFSAQ SLAQAIGSQIEDARRAAEPSLVGLPQTISGDSGGMSAVSDGSSSSLAASASLFPLKVLPL TTPLVDGEDESSSGASVVAIDNKIEQAMDLVKSHLMYAVREEVEVLKEQIKELIEKNSQL EQENNLLKTLASPEQLAQFQAQLQTGSPPATTQPQGTTQPPAQPASQGSGPTA
UCSC uc001uzm.5; human. [Q15714-1];
Related products with Human TSC22D1 ELISA Kit