Product Name:

Human TTLL3 ELISA Kit

  Contact Us
Alternative name: Human HOTTL ELISA Kit;Human tubulin--tyrosine ligase-like protein 3 ELISA Kit;Human tubulin tyrosine ligase like 3 ELISA Kit;Human tubulin monoglycylase TTLL3 ELISA Kit;Human tubulin tyrosine ligase-like family, member 3 ELISA Kit;
Catalog: E039820
species: Human
Gene: TTLL3
Other Species: Human ARPC4-TTLL3 ELISA Kit
Mouse ARPC4-TTLL3 ELISA Kit
Mouse Ttll3 ELISA Kit
Samples: Serum, Plasma , tissue homogenates,Cell culture supernates,Other biological fluids.
Intended Use: Human TTLL3 ELISA Kit allows for the in vitro quantitative determination of TTLL3 , concentrations in serum, Plasma , tissue homogenates and Cell culture supernates and Other biological fluids.
Storage: Store the whole ELISA kit at 4℃
  Human Tubulin monoglycylase TTLL3 Protein information
Uniprot ID TTLL3_HUMAN
Uniprot AC Q9Y4R7; Q4KMS8; Q6AWA3; Q6ZU95; Q8NDN8; Q96GG8; Q9H876; Q9UI99;
UniGene Hs.726435;
>GeneID 26140
KEGG hsa:26140;
Human Tubulin monoglycylase TTLL3 Protein SEQUENCE SEQUENCE 772 AA; 87414 MW; C89074C5E98E15C1 CRC64;
MNRLRNAKIYVERAVKQKKIFTIQGCYPVIRCLLRRRGWVEKKMVHRSGPTLLPPQKDLD SSAMGDSDTTEDEDEDEDEEFQPSQLFDFDDLLKFDDLDGTHALMVGLCLNLRNLPWFDE VDANSFFPRCYCLGAEDDKKAFIEDFWLTAARNVLKLVVKSEWKSYPIQAVEEEASGDKQ PKKQEKNPVLVSPEFVDEALCACEEYLSNLAHMDIDKDLEAPLYLTPEGWSLFLQRYYQV VHEGAELRHLDTQVQRCEDILQQLQAVVPQIDMEGDRNIWIVKPGAKSRGRGIMCMDHLE EMLKLVNGNPVVMKDGKWVVQKYIERPLLIFGTKFDLRQWFLVTDWNPLTVWFYRDSYIR FSTQPFSLKNLDNSVHLCNNSIQKHLENSCHRHPLLPPDNMWSSQRFQAHLQEMGAPNAW STIIVPGMKDAVIHALQTSQDTVQCRKASFELYGADFVFGEDFQPWLIEINASPTMAPST AVTARLCAGVQADTLRVVIDRMLDRNCDTGAFELIYKQPAVEVPQYVGIRLLVEGFTIKK PMAMCHRRMGVRPAVPLLTQRGSGEARHHFPSLHTKAQLPSPHVLRHQGQVLRRQHSKLV GTKALSTTGKALRTLPTAKVFISLPPNLDFKVAPSILKPRKAPALLCLRGPQLEVPCCLC PLKSEQFLAPVGRSRPKANSRPDCDKPRAEACPMKRLSPLKPLPLVGTFQRRRGLGDMKL GKPLLRFPTALVLDPTPNKKKQVKYLGLDSIAVGGSRVDGARPCTPGSTARA
UCSC uc003bti.5; human. [Q9Y4R7-1];
Related products with Human TTLL3 ELISA Kit