Product Name:

Human ZNF701 ELISA Kit

  Contact Us
Alternative name: Human zinc finger protein 701 ELISA Kit;
Catalog: E041318
species: Human
Gene: ZNF701
Samples: Serum, Plasma , tissue homogenates,Cell culture supernates,Other biological fluids.
Intended Use: Human ZNF701 ELISA Kit allows for the in vitro quantitative determination of ZNF701 , concentrations in serum, Plasma , tissue homogenates and Cell culture supernates and Other biological fluids.
Storage: Store the whole ELISA kit at 4℃
  Human Zinc finger protein 701 Protein information
Uniprot ID ZN701_HUMAN
Uniprot AC Q9NV72; A2RRM8; B9EGF2; F5GZM6; Q66K42;
UniGene Hs.235167;
>GeneID 55762
KEGG hsa:55762;
Human Zinc finger protein 701 Protein SEQUENCE SEQUENCE 531 AA; 60903 MW; 0C93D18DC4B2BEBE CRC64;
MGFLHVGQDGLELPTSGDPPASASQSAGITGVSHRTQPPCFEGLTSKDLVREEKTRKRKR KAKESGMALLQGLLTFRDVAIEFSQEEWKCLDPAQRTLYRDVMLENYRNLVSLDTSSKCM MKMFSSTGQGNTEVVHTGTLQIHASHHIGDTCFQEIEKDIHDFVFQWQENETNGHEALMT KTKKLMSSTERHDQRHAGNKPIKNELGSSFHSHLPEVHIFHPEGKIGNQVEKAINDAFSV SASQRISCRPKTRISNKYRNNFLQSSLLTQKREVHTREKSFQRNESGKAFNGSSLLKKHQ IIHLGDKQYKCDVCGKDFHQKRYLACHRCHTGENPYTCNECGKTFSHNSALLVHKAIHTG EKPYKCNECGKVFNQQSNLARHHRVHTGEKPYKCEECDKVFSRKSHLERHRRIHTGEKPY KCKVCDKAFRRDSHLAQHTVIHTGEKPYKCNECGKTFVQNSSLVMHKVIHTGEKRYKCNE CGKVFNHKSNLACHRRLHTGEKPYKCNECGKVFNRKSNLERHHRLHTGKKS
UCSC uc002pzs.3; human. [Q9NV72-1];