Product Name:

Human ZNF704 ELISA Kit

  Contact Us
Alternative name: Human Gig1 ELISA Kit;Human zinc finger protein 704 ELISA Kit;
Catalog: E041320
species: Human
Gene: ZNF704
Other Species: Mouse Znf704 ELISA Kit
Samples: Serum, Plasma , tissue homogenates,Cell culture supernates,Other biological fluids.
Intended Use: Human ZNF704 ELISA Kit allows for the in vitro quantitative determination of ZNF704 , concentrations in serum, Plasma , tissue homogenates and Cell culture supernates and Other biological fluids.
Storage: Store the whole ELISA kit at 4℃
  Human Zinc finger protein 704 Protein information
Uniprot ID ZN704_HUMAN
Uniprot AC Q6ZNC4; B2RNE6; B9EGW6;
UniGene Hs.434957;
>GeneID 619279
KEGG hsa:619279;
Human Zinc finger protein 704 Protein SEQUENCE SEQUENCE 412 AA; 45276 MW; 3093527F3415E748 CRC64;
MTFTFQSEDLKRDCGKKMSHQHVFSLAMEEDVKTADTKKASRILDHEKENTRSICLLEQK RKVVSSNIDVPPARKSSEELDMDKVTAAMVLTSLSTSPLVRSPPVRPNESLSGSWKEGGC VPSSTSSSGYWSWSAPSDQSNPSTPSPPLSADSFKPFRSPAQPDDGIDEAEASNLLFDEP IPRKRKNSMKVMFKCLWKNCGKVLSTAAGIQKHIRTIHLGRVGDSDYSDGEEDFYYTEIK LNTDSVADGLSSLAPVSPSQSLASPPTFPIPDSSRTETPCAKTETKLMTPLSRSAPTTLY LVHTDHAYQATPPVTIPGSAKFTPNGSSFSISWQSPPVTFTGIPVSPTHHPVGTGEQRQH AHTVLSSPPRGTVSLRKPRGEGKKCRKVYGMENRDMWCTACRWKKACQRFLD
UCSC uc003yby.2; human.;