Product Name:

Human ZNF705A ELISA Kit

  Contact Us
Alternative name: Human zinc finger protein 705A ELISA Kit;
Catalog: E041321
species: Human
Gene: ZNF705A
Samples: Serum, Plasma , tissue homogenates,Cell culture supernates,Other biological fluids.
Intended Use: Human ZNF705A ELISA Kit allows for the in vitro quantitative determination of ZNF705A , concentrations in serum, Plasma , tissue homogenates and Cell culture supernates and Other biological fluids.
Storage: Store the whole ELISA kit at 4℃
  Human Zinc finger protein 705A Protein information
Uniprot ID Z705A_HUMAN
Uniprot AC Q6ZN79;
UniGene Hs.438536;
>GeneID 440077
KEGG hsa:440077;
Human Zinc finger protein 705A Protein SEQUENCE SEQUENCE 300 AA; 34734 MW; 88D49C592D7D8AA7 CRC64;
MHSLKKVTFEDVAIDFTQEEWAMMDTSKRKLYRDVMLENISHLVSLGYQISKSYIILQLE QGKELWREGREFLQDQNPDRESALKKKHMISMHPITRKDASTSMTMENSLILEDPFECND SGEDCTHSSTITQRLLTHSGKKPYVSKQCGKSLRNLFSPKPHKQIHTKGKSYQCNLCEKA YTNCFRLRRHKMTHTGERPYACHLCGKAFTQCSHLRRHEKTHTGERPYKCHQCGKAFIQS FNLRRHERTHLGKKCYECDKSGKAFSQSSGFRGNKIIHTGEKPHACLLCGKAFSLSSDLR
UCSC uc001qud.2; human.;