Product Name:

Mouse Tmem101 ELISA Kit

  Contact Us
Alternative name: Mouse 2610511E22Rik ELISA Kit;Mouse transmembrane protein 101 ELISA Kit;
Catalog: E070886
species: Mouse
Gene: Tmem101
Other Species: Human TMEM101 ELISA Kit
Bovine TMEM101 ELISA Kit
Samples: Serum, Plasma , tissue homogenates,Cell culture supernates,Other biological fluids.
Intended Use: Mouse Tmem101 ELISA Kit allows for the in vitro quantitative determination of Tmem101 , concentrations in serum, Plasma , tissue homogenates and Cell culture supernates and Other biological fluids.
Storage: Store the whole ELISA kit at 4℃
  Mouse Transmembrane protein 101 Protein information
Uniprot ID TM101_MOUSE
Uniprot AC Q91VP7; Q9CZW0;
UniGene Mm.46529;
>GeneID 76547
KEGG mmu:76547;
Mouse Transmembrane protein 101 Protein SEQUENCE SEQUENCE 257 AA; 28783 MW; 84FB27B43A6C775A CRC64;
MASKIGSRRWMLQLIMQLGSVLLTRCPFWGCFSQLMLYAERAEARRKPDIPVPYLYFDMG AAVLCASFMSFGVKRRWFALGAALQLAISTYTAYIGGYVHYGDWLKVRMYSRTVAIIGGF LVLASGAGELYRRKPRSRSLQSTGQVFLGIYLICVAYSLQHSKEDRLAYLNHLPGGELMV QLFFVLYGVLALAFLSGYYVTLAAQILAVLLPPVMLLIDGNVSYWHNTRRVEFWNQMKLL GESVGIFGAAVILATDG
UCSC uc007lqr.2; mouse.;