Product Name:

Human GCM2 ELISA Kit

  Contact Us
Alternative name: Human hGCMb ELISA Kit;Human GCM motif protein 2 ELISA Kit;Human glial cells missing homolog 2 ELISA Kit;Human GCMB ELISA Kit;Human HRPT4 ELISA Kit;Human chorion-specific transcription factor GCMb ELISA Kit;Human glial cells missing 2 ELISA Kit;Human glial cells missing homolog b ELISA Kit;Human glide/gcm protein homolog ELISA Kit;
Catalog: E008340
species: Human
Gene: GCM2
Other Species: Mouse Gcm2 ELISA Kit
Samples: Serum, Plasma , tissue homogenates,Cell culture supernates,Other biological fluids.
Intended Use: Human GCM2 ELISA Kit allows for the in vitro quantitative determination of GCM2 , concentrations in serum, Plasma , tissue homogenates and Cell culture supernates and Other biological fluids.
Storage: Store the whole ELISA kit at 4℃
Product Categories/Family: Epigenetics and Nuclear Signaling
  Human Chorion-specific transcription factor GCMb Protein information
Uniprot ID GCM2_HUMAN
Uniprot AC O75603; D3GDV6; Q5THN5;
UniGene Hs.227098;
>GeneID 9247
KEGG hsa:9247;
Human Chorion-specific transcription factor GCMb Protein SEQUENCE SEQUENCE 506 AA; 56610 MW; 1B3864F65F54DA0F CRC64;
MPAAAVQEAVGVCSYGMQLSWDINDPQMPQELALFDQFREWPDGYVRFIYSSDEKKAQRH LSGWAMRNTNNHNGHILKKSCLGVVVCTQACTLPDGSRLQLRPAICDKARLKQQKKACPN CHSALELIPCRGHSGYPVTNFWRLDGNAIFFQAKGVHDHPRPESKSETEARRSAIKRQMA SFYQPQKKRIRESEAEENQDSSGHFSNIPPLENPEDFDIVTETSFPIPGQPCPSFPKSDV YKATCDLATFQGDKMPPFQKYSSPRIYLPRPPCSYELANPGYTNSSPYPTLYKDSTSIPN DTDWVHLNTLQCNVNSYSSYERSFDFTNKQHGWKPALGKPSLVERTNHGQFQAMATRPYY NPELPCRYLTTPPPGAPALQTVITTTTKVSYQAYQPPAMKYSDSVREVKSLSSCNYAPED TGMSVYPEPWGPPVTVTRAASPSGPPPMKIAGDCRAIRPTVAIPHEPVSSRTDEAETWDV CLSGLGSAVSYSDRVGPFFTYNNEDF
UCSC uc003mzn.5; human.;
Related products with Human GCM2 ELISA Kit